PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do003551.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB_related
Protein Properties Length: 243aa    MW: 26989.2 Da    PI: 6.7102
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do003551.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.6e-173882147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
       Do003551.1 38 RGKITPQEESIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 82
                     8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.204132IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.5E-111845IPR009057Homeodomain-like
SuperFamilySSF466892.22E-201886IPR009057Homeodomain-like
PROSITE profilePS5129425.3963387IPR017930Myb domain
SMARTSM007176.6E-163785IPR001005SANT/Myb domain
PfamPF002498.0E-153882IPR001005SANT/Myb domain
CDDcd001673.66E-114283No hitNo description
Gene3DG3DSA:1.10.10.606.2E-204683IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MLYLLTSQNF RWRLNGLKRS GKSCRLRWVN YLRPDLKRGK ITPQEESIIV QLHALWGNRW  60
STIARSLPGR TDNEIKNYWR THFKKGKPSK NIERARARFL KQRQEMQNQK QQQLLQQEQV  120
AKNDVNEDGG ARAVTADDDD RGSAVVDDAC AAPPAVAETG GHHHHEDLIM DDAMDFMWPM  180
SCALLLHGAV HGAGAGGSCC GSTASDEYGS SEEDGATWGS LWNLDGLVVD DVAVDGAGAC  240
TLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-17198540106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096201e-105AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978126.11e-109PREDICTED: transcription repressor MYB6-like
TrEMBLK3Y9D01e-109K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m1e-109(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.14e-43myb domain protein 79